DesignloungeDesignloungeDesignlounge
0
0€0,00

Family T-Shirt Set of 3 | THE KING & QUEEN

€49,90

Tax included. Shipping calculated at checkout.
kalles saleDHL Hoursminutes
  • Kostenloser Versand
  • Lieferzeit: 3-4 Tage Werktage
  • Kauf auf Rechnung (inkl. Käuferschutz)
  • Bezahl nach 30 Tagen mit Klarna
  • Hergestellt in Deutschland

Color: White

  • White
  • Black
Will not ship until [19041994]
Out of stock

Pay securely with

immediatelyklarnavisapaypalapple payamazon payments

Personalized T-shirts as a family set of 3 with desired names under the given motifs.

Your desired name or date will be immortalized.

The product and motif is available in different colours.

The loose cut makes these shirts an ultra-comfortable companion in your free time. A solid combination of durability and soft quality.
  • High-quality workmanship: double stitching on the hems
  • Straight cut for men
  • Tailored cut for women
  • Soft fabric quality: 153 g/m² (white: 144 g/m²)

material: 100% cotton

Fit: regular fit

Care instructions: washable at 40°C, suitable for tumble drying, ironing allowed

Gift for your loved ones for the upcoming holiday? Then give away the personal T-shirt set with personalization. This extraordinary declaration of love will remind the families of your infinite solidarity and deep love every day.

Welche Größe brauche ich?

Unsere Hoodies & Shirts fallen optimal aus. Daher empfehlen wir deine gewohnte Größe. Ansonsten haben wir auf allen Produktseiten eine Größentabelle.

Wieso ändert sich nichts auf dem Foto wenn ich mein Namen eintippe?

Mach dir keine Sorgen, das ändert sich nicht. Dein Wunschname bzw. Datum wird genau so aussehen wie auf den Produktfotos. Es ist für uns wichtig, was du in den Feldern eigetragen hast.

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist